PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_22454A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NAC
Protein Properties Length: 364aa    MW: 39450.3 Da    PI: 5.122
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_22454AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM45.42.6e-14721988128
                        NAM   8 hPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrk.nratk..sgyW 83 
                                hP+   l+ +yL++ v++  + +   ++ +d+y+++P +L++      ++ +e+ wyf s  +     g  +  r+++  +g W
  Oropetium_20150105_22454A  72 HPSTVALIEDYLRPWVASGCTVV-PYVHVADVYSADPGELEEmfapaVAQDGERAWYFLSMLQPLMGVGWTPfMRTVEsgAGEW 154
                                89999************999777.779999**********85477755566888********999998765415665533677* PP

                        NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                +++ k+  v++ ++++vg  + + fyk ++   + t W+m e rl
  Oropetium_20150105_22454A 155 HNQAKEMVVFD-GNRQVGRLQRFHFYKRKRGVRVPTGWIMWELRL 198
                                *****999999.999***********988888899*****99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100522.09965220IPR003441NAC domain
PfamPF023651.3E-772198IPR003441NAC domain
SuperFamilySSF1019411.44E-2372220IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MNDPAAHSAL NRPLHPSGLR VLHAGVVLFK VGAVNRRIPH RLAHGLESNP SKRKPIRRRQ  60
LEGAHIASLD SHPSTVALIE DYLRPWVASG CTVVPYVHVA DVYSADPGEL EEMFAPAVAQ  120
DGERAWYFLS MLQPLMGVGW TPFMRTVESG AGEWHNQAKE MVVFDGNRQV GRLQRFHFYK  180
RKRGVRVPTG WIMWELRLGI DVGCSDHDED LCVLCKVYCS PGHPSWPCDG EPAAEAVVDD  240
GPEEDDESTS ETRDLGEKPA DGNFSAESVA TAALTLGPGE KPANDDASAE TFVAAPALQS  300
DDSSAGLQPP SDLALVESYL HPGAGVTPQQ TSRTMLGGRI DSSLPFKVFE CVGMFNRSCT  360
DPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40112972
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-11NAC domain containing protein 2